Alamy logo

From left to right: U.S. Public Health Surgeon General Rear Admiral Sylvia Trent-Adams, U.S. Air Force Surgeon General Lt. Gen. Mark Ediger, U.S. Navy Surgeon General Vice Admiral Forrest Faison, and U.S. Army Surgeon General Nadja West. During the Uniformed Services University of the Health Sciences commencement exercise on May 20, graduating medical students recited their respective service commissioning oath, led individually by each of the Surgeon Generals.

From left to right: U.S. Public Health Surgeon General Rear Admiral Sylvia Trent-Adams, U.S. Air Force Surgeon General Lt. Gen. Mark Ediger, U.S. Navy Surgeon General Vice Admiral Forrest Faison, and U.S. Army Surgeon General Nadja West. During the Uniformed Services University of the Health Sciences commencement exercise on May 20, graduating medical students recited their respective service commissioning oath, led individually by each of the Surgeon Generals. Stock Photo
Preview

Image details

Contributor:

Ted Small / Alamy Stock Photo

Image ID:

R6K99H

File size:

5.7 MB (161.4 KB Compressed download)

Releases:

Model - no | Property - noDo I need a release?

Dimensions:

1732 x 1155 px | 29.3 x 19.6 cm | 11.5 x 7.7 inches | 150dpi

More information:

This image is a public domain image, which means either that copyright has expired in the image or the copyright holder has waived their copyright. Alamy charges you a fee for access to the high resolution copy of the image.

This image could have imperfections as it’s either historical or reportage.

Search stock photos by tags

air forcearchivearmed forcesarmydefencemilitarynavyreportageserviceservicemanservicemensoldieruniformed services university of the health sciencesunited statesunited states of americaususa