Alamy logo

. The Biological bulletin. Biology; Zoology; Biology; Marine Biology. ASCIDIAN ENDOSTYLE-SPECIFIC GENES 63 B MKVLLILLAFIAAASAFSYGNGYGYGYNKCY6SYKGYSSGCYSYGYRK CYVYPKSQVFCYNIPYKKSWCSYKYYEPVLHVYPGCDCGTEGWTEKTV ADLEIEMTNLLKEALLKITTEMNNCKTTFVEQLKSSIEQYKLNVKNKL FNYYAYYIQSAKTDEERENLIKKRDDAIKEYNEELDKKRDDVILKCEE DVADKLKCIADYHTKLVENGVECLKTRLTKIVDYTTTLTAKCVOYVKN YVACHMSILEQKKSYYRSFLHKVHGSSEWEKVTVOAVIQLYHOQEVAK ITALATEYATKLATWKLKLIMNYSCAYRCYMSNGCIRFYKKRYYSTCK RYGCWYKYKTRYCFVRYCLQPFKFCFNPTKYTGLKTCVFPAVVRDGAT IIKEHCEKLEKAILEYETQFGEWKLKWTTYHTEYCTKYDEIIKARHDW YIEYLRSQYICANNSTELTDEQKAKLAEVQKECDEKRTAAVEAYKLKL A

. The Biological bulletin. Biology; Zoology; Biology; Marine Biology. ASCIDIAN ENDOSTYLE-SPECIFIC GENES 63 B MKVLLILLAFIAAASAFSYGNGYGYGYNKCY6SYKGYSSGCYSYGYRK CYVYPKSQVFCYNIPYKKSWCSYKYYEPVLHVYPGCDCGTEGWTEKTV ADLEIEMTNLLKEALLKITTEMNNCKTTFVEQLKSSIEQYKLNVKNKL FNYYAYYIQSAKTDEERENLIKKRDDAIKEYNEELDKKRDDVILKCEE DVADKLKCIADYHTKLVENGVECLKTRLTKIVDYTTTLTAKCVOYVKN YVACHMSILEQKKSYYRSFLHKVHGSSEWEKVTVOAVIQLYHOQEVAK ITALATEYATKLATWKLKLIMNYSCAYRCYMSNGCIRFYKKRYYSTCK RYGCWYKYKTRYCFVRYCLQPFKFCFNPTKYTGLKTCVFPAVVRDGAT IIKEHCEKLEKAILEYETQFGEWKLKWTTYHTEYCTKYDEIIKARHDW YIEYLRSQYICANNSTELTDEQKAKLAEVQKECDEKRTAAVEAYKLKL A Stock Photo
Preview

Image details

Contributor:

Library Book Collection / Alamy Stock Photo

Image ID:

RHKNPD

File size:

7.1 MB (0.3 MB Compressed download)

Releases:

Model - no | Property - noDo I need a release?

Dimensions:

1062 x 2353 px | 18 x 39.8 cm | 7.1 x 15.7 inches | 150dpi

More information:

This image is a public domain image, which means either that copyright has expired in the image or the copyright holder has waived their copyright. Alamy charges you a fee for access to the high resolution copy of the image.

This image could have imperfections as it’s either historical or reportage.

. The Biological bulletin. Biology; Zoology; Biology; Marine Biology. ASCIDIAN ENDOSTYLE-SPECIFIC GENES 63 B MKVLLILLAFIAAASAFSYGNGYGYGYNKCY6SYKGYSSGCYSYGYRK CYVYPKSQVFCYNIPYKKSWCSYKYYEPVLHVYPGCDCGTEGWTEKTV ADLEIEMTNLLKEALLKITTEMNNCKTTFVEQLKSSIEQYKLNVKNKL FNYYAYYIQSAKTDEERENLIKKRDDAIKEYNEELDKKRDDVILKCEE DVADKLKCIADYHTKLVENGVECLKTRLTKIVDYTTTLTAKCVOYVKN YVACHMSILEQKKSYYRSFLHKVHGSSEWEKVTVOAVIQLYHOQEVAK ITALATEYATKLATWKLKLIMNYSCAYRCYMSNGCIRFYKKRYYSTCK RYGCWYKYKTRYCFVRYCLQPFKFCFNPTKYTGLKTCVFPAVVRDGAT IIKEHCEKLEKAILEYETQFGEWKLKWTTYHTEYCTKYDEIIKARHDW YIEYLRSQYICANNSTELTDEQKAKLAEVQKECDEKRTAAVEAYKLKL AEILLECATKFSTS11DYRTKAKSYIQSIGDNFDACQKKRSEDIKAYK EKLEAKGISAKQSLFDSMNKAKKSHLTKYLDILKLHHDOFVVNGDVCD GPTDIVTMANKYSEKLSEYCAAVLLECDKYWED11RTGRTSSLGWYST IPAATSARNRSASCPDSAGWITHGA 65033 D 3.00 0.00 -3.00 i 141 281 421 561 701 Si Q. •g - m s. o 2.3kb. Figure 2. Characterization of the CiEmlsl gene. (A) The predicted sequence of 650 amino acids of CiENDSl. The predicted signal peptide sequence is shown by red capitals, and putative N-linked glycosyla- tion sites by green capitals. The nucleotide sequence for CiEmlsl will appear under the accession number of ABO 10895 in the DDBJ, EMBL, and GenBunk nucleotide sequence databases. IB) Mean hydropathy index of the CiENDSl calculated across a window of 19 residues according to the method of Kyle and Doolittle (1982). The N-terminus of the protein is characterized by a 16-amino-acid-long hydrophobic region that contains the predicted signal peptide sequence (see text for details). This suggests that CiENDSl is a secretory protein. (C) Distribution of CiEndsl transcript in tissues and organs of the adult. Northern blots of poly(A)+ RNA prepared from the endostyle (En), pharyngeal gill (PhG). body-wall muscle (BWM). intestine (Int), and gonad (Gonad) were hybridized with the random-primed ["P]-labeled DNA probes, and the membrane was washed under high-stringency conditions. The CiEndsl transcript of about 2.3 kb in length was detected onl