Alamy logo

. The Biological bulletin. Biology; Zoology; Biology; Marine Biology. 64 M. OGASAWARA AND NOR1YUKI SATOH AMKILFVLLAALAVTNAYSYTHCGCKRFLVYPKPQAFCYHIQYKSCWCS YKYYEPVLHVYPGKDCGTLGWTETPIEOLQTEMENLLKESLLEITKKM MLRKWFVRQLTKTADEYKEEYKKN ITRYYAYYIASADSILRKEHLIK ERNELIEEYNEQLDQKVTAAVEKCTTOILAKIKI IAAYHEKLVKSAVG CLETREQKIEEYITTLENKCKLYVGRFVSKHLAILEQNKKYYRATLAK VHGSALWQKAKVDAVIEVYHEQEAKKISVLAKEYAOTLNTCKAKLITN YRCAYKCYMSNSCLRFYKKTYYSYCRNLGCWYKYTPSYCVVRKTLCPF YYPYKPISFSCLRTCVVPAVVRNGATI IKELEEKLEKAIKEYVVIFTA WKTKWTQYHTEYCDKYNEILKERHEWYIRRVIARFVVENNSTELTALQ KAEIAKLKKELNERRTEAVLTYKKKLLNLLLECVAKFNENIEEYKQKA LD

. The Biological bulletin. Biology; Zoology; Biology; Marine Biology. 64 M. OGASAWARA AND NOR1YUKI SATOH AMKILFVLLAALAVTNAYSYTHCGCKRFLVYPKPQAFCYHIQYKSCWCS YKYYEPVLHVYPGKDCGTLGWTETPIEOLQTEMENLLKESLLEITKKM MLRKWFVRQLTKTADEYKEEYKKN ITRYYAYYIASADSILRKEHLIK ERNELIEEYNEQLDQKVTAAVEKCTTOILAKIKI IAAYHEKLVKSAVG CLETREQKIEEYITTLENKCKLYVGRFVSKHLAILEQNKKYYRATLAK VHGSALWQKAKVDAVIEVYHEQEAKKISVLAKEYAOTLNTCKAKLITN YRCAYKCYMSNSCLRFYKKTYYSYCRNLGCWYKYTPSYCVVRKTLCPF YYPYKPISFSCLRTCVVPAVVRNGATI IKELEEKLEKAIKEYVVIFTA WKTKWTQYHTEYCDKYNEILKERHEWYIRRVIARFVVENNSTELTALQ KAEIAKLKKELNERRTEAVLTYKKKLLNLLLECVAKFNENIEEYKQKA LD Stock Photo
Preview

Image details

Contributor:

Library Book Collection / Alamy Stock Photo

Image ID:

RHKNNP

File size:

7.1 MB (0.2 MB Compressed download)

Releases:

Model - no | Property - noDo I need a release?

Dimensions:

1453 x 1719 px | 24.6 x 29.1 cm | 9.7 x 11.5 inches | 150dpi

More information:

This image is a public domain image, which means either that copyright has expired in the image or the copyright holder has waived their copyright. Alamy charges you a fee for access to the high resolution copy of the image.

This image could have imperfections as it’s either historical or reportage.

. The Biological bulletin. Biology; Zoology; Biology; Marine Biology. 64 M. OGASAWARA AND NOR1YUKI SATOH AMKILFVLLAALAVTNAYSYTHCGCKRFLVYPKPQAFCYHIQYKSCWCS YKYYEPVLHVYPGKDCGTLGWTETPIEOLQTEMENLLKESLLEITKKM MLRKWFVRQLTKTADEYKEEYKKN ITRYYAYYIASADSILRKEHLIK ERNELIEEYNEQLDQKVTAAVEKCTTOILAKIKI IAAYHEKLVKSAVG CLETREQKIEEYITTLENKCKLYVGRFVSKHLAILEQNKKYYRATLAK VHGSALWQKAKVDAVIEVYHEQEAKKISVLAKEYAOTLNTCKAKLITN YRCAYKCYMSNSCLRFYKKTYYSYCRNLGCWYKYTPSYCVVRKTLCPF YYPYKPISFSCLRTCVVPAVVRNGATI IKELEEKLEKAIKEYVVIFTA WKTKWTQYHTEYCDKYNEILKERHEWYIRRVIARFVVENNSTELTALQ KAEIAKLKKELNERRTEAVLTYKKKLLNLLLECVAKFNENIEEYKQKA LDLI KG IAKAFDACLTKRKAOILAYRFKMIKHSFSEKEIMRKDMIKSK LVHLRHYKEMLKTYHDGEEFPEEVNAMIEAYEDKLENYCEDILEECTK DWSAAIPKLTHHYACSYTCREGRFCMPKFCFGGYFRfVVKYPTAKCYT YYYRCYRTTCNYRVFYQKGCYRYGCH gen gg B. 3.00 OS c C C. > *± O 111 n m C en 2.3kb. Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original work.. Marine Biological Laboratory (Woods Hole, Mass. ); Marine Biological Laboratory (Woods Hole, Mass. ). Annual report 1907/08-1952; Lillie, Frank Rattray, 1870-1947; Moore, Carl Richard, 1892-; Redfield, Alfred Clarence, 1890-1983. Woods Hole, Mass. : Marine Biological Laboratory