Ford M 151 A2
- Image ID: CW28P6
Ford M 151 A2
CPC Collection / Alamy Stock Photo
Image ID: CW28P6
This image is a public domain image, which means either that copyright has expired in the image or the copyright holder has waived their copyright. Alamy charges you a fee for access to the high resolution copy of the image.
Search stock photos by tags
151a2actionaggressionarmedarmorarmoredarmourarmouredarmy artilleryautomobilebarrelbattlebombcamouflagecar carriercarriercommanderconflictdangerdefenseequipmentfightfightingfirearmforcefordfrontgreengunheavy infantrykhakilaunchermachinemarinemilitarymissilemissionmotoroldordnancepowerprotectionsoldiertanktracktrackedtrackstransporttransportationtruckturretuniformvehiclewarwarfarewartimeweaponwheel