An Iraqi soldier assigned to 1st Company, 1st Battalion, 28th Mechanized Brigade, 7th Iraqi Army Division provides security dur
- Image ID: E1G9MN
An Iraqi soldier assigned to 1st Company, 1st Battalion, 28th Mechanized Brigade, 7th Iraqi Army Division provides security dur
501 collection / Alamy Stock Photo
Image ID: E1G9MN
This image is a public domain image, which means either that copyright has expired in the image or the copyright holder has waived their copyright. Alamy charges you a fee for access to the high resolution copy of the image.
Search stock photos by tags
10th cavalry regiment1st battalion2011 u.s soldiers assigned to 4th squadron28th mechanized brigade28th mechanized brigade an iraqi soldier assigned to 1st company3rd advise and assist brigade4th7thairforcealarmyasadassistedcampdawndivisiondodduringexercisefeb 12garyininfantryiraqiraqimilitarymovementnavynewoperationphotoprovidessecuritysilvermansoldiersspcsquadsupporttrainingu.s army/released iraqi soldierunitedususa